SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7KXR4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7KXR4
Domain Number 1 Region: 8-108
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.2e-28
Family SCOPe 0.0000244
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q7KXR4
Sequence length 111
Comment (tr|Q7KXR4|Q7KXR4_PLAFA) Glutaredoxin-1 {ECO:0000313|EMBL:AAK91589.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=grx-1 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MAGTSEAVKKWVNKIIEENIIAVFAKTECPYCIKAISILKGYNLNSHMHVENIEKNPDMA
NIQAYLKELTGKSSVPRIFINKDVVGGCDDLVKENDEGKLKERLQKLGLVN
Download sequence
Identical sequences A0A024VD23 A0A0L7K8U1 A0A2I0BTG5 Q7KXR4 Q9NLB2 W7FQ10
cath|current|4hjmA00/6-111 cath|current|4kjeA00/6-111 cath|current|4kjfA00/6-111 cath|current|4mzbA00/6-111 cath|current|4mzcA00/6-111 cath|current|4n0zA00/5-111 cath|current|4n10A00/5-111 cath|current|4n11A00/4-111 XP_001351139.1.26446 5833.PFC0271c-1 4hjm_A 4mzb_A 4mzc_A 4n0z_A 4n10_A 4n11_A PFHG_01066T0 PFC0271c gi|124504793|ref|XP_001351139.1| gi|15375385|emb|CAB89174.1| gi|27530599|dbj|BAC53982.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]