SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7M6X0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7M6X0
Domain Number 1 Region: 9-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.53e-24
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 2 Region: 463-520
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.2e-23
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 3 Region: 519-576
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.44e-23
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 4 Region: 239-296
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.35e-22
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 5 Region: 183-240
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.29e-22
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 6 Region: 295-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.29e-21
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 7 Region: 407-464
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.27e-20
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 8 Region: 128-184
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.43e-18
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 9 Region: 575-632
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.46e-18
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 10 Region: 342-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.14e-18
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 11 Region: 631-686
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.66e-17
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 12 Region: 86-132
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000105
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q7M6X0
Sequence length 694
Comment (tr|Q7M6X0|Q7M6X0_MOUSE) Regulator of sex-limitation candidate 3 {ECO:0000313|EMBL:DAA01861.1} OX=10090 OS=Mus musculus (Mouse). GN=A530054K11Rik OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MEFGAGTSAFFQEMLSFRDVAIDFSAEEWECLEPAQWNLYRDVMLENYSNLVFLGLASCK
PHLITCLEQIQEPSDVKRGAATSMLRGEKCYTCKECGKVFEWTKCSKIMRCFYIGMNPNK
CEECARSFHSPSLSSEENRIHTGEKPYKCEVCGKAFCIPLLLSKHKRVHTGENLYKCEVC
GKAFQHPSRLSRHKKIHSEEKPYKCEVCGKAFHFPSLLLVHKRVHTGEKPYKCEICDKAF
HYPSILSKHKRIHTGEKPYKCEECGKAFHISSFLSKHKIIHRGEKPYKCEVCGKAFHYPS
RLSNHKKIHSGEKPFKCEVCGKAFRILSLLSKHKIIHTEENPYKCEVCGKAFDYPSRLST
HAKMHTGEKPYKCEVCQKAFRSLSSLSKHKRIHTEDNYYNNELCGKAFIYPSRLSKHKRI
CAGEKPYKCEVCGKAFHVSSLLSKHRTIHTGEKLYKCEVCGKAFYYPSRLSNHKKIHTGE
KPFQCEVCGKAFCFPSSLSKHKRIHTGEKPYKCKECGKAFRSLSSLSKHKRIHTGEKPYK
CEECGKAFHYPSLLSKHKIIHTEEKPYKCDVCGQAFHVPSKLSHHKIIHTGEKPYKCEVC
GKAFCIPLLLSKHKRVHTGENPYNSQVCSKAFVYPSKLSKHKKVRTKEKPYKCEVCGKPS
AFPSLLLIHQGMHTGEKPYKCEDCGQPAIIHHYF
Download sequence
Identical sequences Q7M6X0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]