SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7N4E0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7N4E0
Domain Number 1 Region: 59-332
Classification Level Classification E-value
Superfamily PMT central region-like 3.66e-102
Family PMT central region-like 0.0002
Further Details:      
 
Domain Number 2 Region: 334-558
Classification Level Classification E-value
Superfamily EreA/ChaN-like 3.4e-74
Family PMT domain-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q7N4E0
Sequence length 568
Comment (tr|Q7N4E0|Q7N4E0_PHOLL) Uncharacterized protein {ECO:0000313|EMBL:CAE14745.1} KW=Complete proteome; Reference proteome OX=243265 OS=105565 / TT01). GN=plu2400 OC=Morganellaceae; Photorhabdus.
Sequence
MTGVSECSQQRSNLKDDGYISSRKLTGDNMVYEYDKTIERRRNPSIQLNNNEKSSEQALE
LSQNNPLLHDLITSNNLRKEAAVFAKRIGPSYQEILDELEHLHHLSGNEQLAAGFELHRR
ITHYLEEHPDSKRNTALRRTQTQFGDLMFTGTLQKIRHSLLEMAETRPEMASHIYQIARE
EVKGNTPGLTDLMVRWVKEDPYLAAKTGYQGKIPNDLPFEPKFHVELGAQFDDFKKWLDT
AQSKELLTHTRLDEQNKQVHLGYSYNELLDMTGVESVQMAVYFLKEAAKQAEPGSTKSQE
DILLHRFANPTYLAQLEHSRLAQIEAIYHSSHDTDVTAWDQQFASDALTQFNHQLNNTVD
LNSQLSLLLKDRQGLLIGESHGSDLNGLRFVEEQMEVLKAHGVTVIGLEHLRSDLAQPLI
DKFLASGNEPMPAELAALLKTKHLSANLFEQARSKQMKIIALDNNSTTRPTVEGTQHGLM
YRAGAANNVAVERLRQLPAGEKFVAIYGNAHLQSHEGIDHFLPGITHRLGLPALKVDENN
RFTAQVDNINQRKRYDDVVELPRIQLTS
Download sequence
Identical sequences Q7N4E0
WP_011146635.1.100813 WP_011146635.1.49830 243265.plu2400 gi|37526301|ref|NP_929645.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]