SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7ND67 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7ND67
Domain Number 1 Region: 6-417
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.66e-181
Family GABA-aminotransferase-like 0.000000000325
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q7ND67
Sequence length 426
Comment (sp|Q7ND67|GLYA_GLOVI) Serine hydroxymethyltransferase {ECO:0000255|HAMAP-Rule:MF_00051} KW=Complete proteome; Reference proteome OX=251221 OS=Gloeobacter violaceus (strain PCC 7421). GN=glr4369; OC=Gloeobacteraceae; Gloeobacter.
Sequence
MPVSDDLLRATDPLVAGWIDRELNRQRSHLELIASENFTSAAVMAAQGSVLTNKYAEGLP
SKRYYGGCEFVDAVEQIAIDRAKALFGAAHANVQPHSGAQANAAVFLALLERGDKILGMD
LSHGGHLTHGSPVNQSGIYFEALHYGVDPASHRIDFDQVRELAHAHRPKLIICGYSAYPR
VIDFECFREIADEVGAYLLADIAHIAGLVVAGVHPNPIPHCDVVTTTTHKTLRGPRGGLI
LTRDEALGKRFDKAVFPGTQGGPLEHVIAAKAVAFGEALQPEFKTYAADVVANARALAER
LTARGLTLVSGGTDNHLMLVDLRSVDLTGKQADLLMSDVNITTNKNTIPFDPQSPFVTSG
LRLGSPAMTTRGLGTTEFGEIGEIIANRLTQPTDARVVADCLERVASLCTRFALYPHLGR
VVAPVG
Download sequence
Identical sequences Q7ND67
251221.gvip567 gi|37523938|ref|NP_927315.1| NP_927315.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]