SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7NEP3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7NEP3
Domain Number 1 Region: 18-101
Classification Level Classification E-value
Superfamily YggU-like 4.19e-27
Family YggU-like 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q7NEP3
Sequence length 111
Comment (sp|Q7NEP3|Y3835_GLOVI) UPF0235 protein glr3835 {ECO:0000255|HAMAP-Rule:MF_00634} KW=Complete proteome; Reference proteome OX=251221 OS=Gloeobacter violaceus (strain PCC 7421). GN=glr3835; OC=Gloeobacteraceae; Gloeobacter.
Sequence
MRSPLPPMPDPEAFPPGAVSVDAGGITLTVWAQPRASCSEVVGWQQNAFKVRLAAPPVEG
KANAECVALIAAFFGVPRRQVSLVQGQQGRHKKIRIEAPADLLLVALQKLS
Download sequence
Identical sequences Q7NEP3
NP_926781.1.44878 gi|37523404|ref|NP_926781.1| 251221.glr3835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]