SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7NER2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7NER2
Domain Number 1 Region: 14-327
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 0.000000000000179
Family Gtf glycosyltransferase 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q7NER2
Sequence length 352
Comment (tr|Q7NER2|Q7NER2_GLOVI) Gll3816 protein {ECO:0000313|EMBL:BAC91757.1} KW=Complete proteome; Reference proteome OX=251221 OS=Gloeobacter violaceus (strain PCC 7421). GN=gll3816 OC=Gloeobacteraceae; Gloeobacter.
Sequence
MPLKLCLYSSAHGFGHTTRLLAVASRLRELEAHSRIVLHSHVPDWLVAVHMAKGLERRGT
LLDVGLVQSDSFTTDRDATLERIRALRARSEELVCAEREWLEQEDFDIVLADIPPLAGRL
ADAKRPVWGMSNFGWDFIYRHIEDERFAPLAAWSAQLYRGYSGLFRLPFAEAMDAFAAVE
PVPLVVNEARFGRDHVRHRLGIAPDRPTALMTFGGLGMAAFPAERVAEHPDWQFVVTAAA
PPAPNLTTVEPGAWRLIELLAAVDLAIIKPGYSTVAECCALGLPVACLARPGFAEADLLI
DGMSRLIDCRVLTTEAFLAQRWDFLDGSLACRPPVPAHGAQQVAERLLAVVR
Download sequence
Identical sequences Q7NER2
gi|37523385|ref|NP_926762.1| 251221.gll3816 NP_926762.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]