SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7NF38 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q7NF38
Domain Number - Region: 41-83
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 0.00053
Family TolA 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q7NF38
Sequence length 341
Comment (tr|Q7NF38|Q7NF38_GLOVI) Gll3688 protein {ECO:0000313|EMBL:BAC91629.1} KW=Complete proteome; Reference proteome OX=251221 OS=Gloeobacter violaceus (strain PCC 7421). GN=gll3688 OC=Gloeobacteraceae; Gloeobacter.
Sequence
MRWLEVAAMMMSFVRSLLLFSGLMVYSASVGTAAELPTGRLAREAVQAQWKLPRLKTDGT
VTVKAKLLSDGHLIDPQLTLGGPLAIEGGEAAELTRRSLEEAIRRAVVDTASRGPVEFTL
QIRSSGRVPGCFPLRVALPVALKDTQETIPEVLFKGLEQGLIKWNAMVVGYAEGKLPEPL
VVVPSPEQADVVVEAFEDYPDYSSYFIDERSGRVVVRMPFKRDVGAWVTQGFRWWHPEQI
TQQTMFQLGRQMGLGLSENNTNVLYPDQSLTIVTSPQKGLGVGTRNVQTIIDGNLVNEYG
GGDRTITSFQLEDAGDFVRTRRCAAERAPASPNVINRPETP
Download sequence
Identical sequences Q7NF38
251221.gll3688 gi|37523257|ref|NP_926634.1| NP_926634.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]