SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7NFH7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7NFH7
Domain Number 1 Region: 5-220
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.62e-73
Family D-ribulose-5-phosphate 3-epimerase 0.000000027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q7NFH7
Sequence length 233
Comment (tr|Q7NFH7|Q7NFH7_GLOVI) Ribulose-phosphate 3-epimerase {ECO:0000256|PIRNR:PIRNR001461} KW=Complete proteome; Reference proteome OX=251221 OS=Gloeobacter violaceus (strain PCC 7421). GN=gll3548 OC=Gloeobacteraceae; Gloeobacter.
Sequence
MAKPVVVAPSILSADFARLGEEIHAIDEAGADWIHVDVMDGRFVPNITIGPLIVKAIRPV
TQKVLDVHLMIVEPEKYIADFAKAGADIITVHCEHNSTVHLHRALSQIKELGKQAGVSLN
PSTPLSLIEYVLDLCDLVLVMSVNPGFGGQSFIPQVLPKIARLKSMCEERGLDPWIEVDG
GLKPSNTWQVLEVGANAIVSGSGVFGVGPARYAEAIEGVRASHRPAVEVAAQV
Download sequence
Identical sequences Q7NFH7
gi|37523117|ref|NP_926494.1| 251221.gll3548 NP_926494.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]