SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7NFQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7NFQ6
Domain Number 1 Region: 1-388
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.71e-97
Family AAT-like 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q7NFQ6
Sequence length 391
Comment (tr|Q7NFQ6|Q7NFQ6_GLOVI) Glr3468 protein {ECO:0000313|EMBL:BAC91409.1} KW=Complete proteome; Reference proteome OX=251221 OS=Gloeobacter violaceus (strain PCC 7421). GN=glr3468 OC=Gloeobacteraceae; Gloeobacter.
Sequence
MRLATRLEKLQSNVFSLMDEAKARARRAGLEVVDLSLGSSDLSPPAHALERIRESILDPT
SHGYLLFQGTRSFREACAAWYERRYGLALDPETEILPLIGSQEGTAHIPLAVLDPGDVAL
LTDPGYPSHEGGVHLAGGQIYPLALRPETGYLPQLEQIPEEVLERSRLLVLSYPHNPTAA
TATLAYFERAVAFCRAHDIVLVHDFPYADFHLSGEQPPSILQADRERAVAIEFFSLSKSF
HMGGFRIGFAVGNRDLVAALRQVKASIDFNQYRGILDGAEAALRGPQDYVREAVAVFRAR
RDRAVAALAQAGWQVPAPEATMYLWAALPECWRGSSAEFCIRLVEQTGVALAPGSGFGSS
GEGYVRFALVRSEDMLERAIAQIAGFLQRSC
Download sequence
Identical sequences Q7NFQ6
251221.glr3468 NP_926414.1.44878 gi|37523037|ref|NP_926414.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]