SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7NJ28 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7NJ28
Domain Number 1 Region: 25-318,467-529
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.98e-65
Family FAD-linked reductases, N-terminal domain 0.033
Further Details:      
 
Domain Number 2 Region: 287-465
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.000000000000628
Family GMC oxidoreductases 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q7NJ28
Sequence length 535
Comment (tr|Q7NJ28|Q7NJ28_GLOVI) Gll2004 protein {ECO:0000313|EMBL:BAC89945.1} KW=Complete proteome; Reference proteome OX=251221 OS=Gloeobacter violaceus (strain PCC 7421). GN=gll2004 OC=Gloeobacteraceae; Gloeobacter.
Sequence
MIPTLAAEPRKPARPPLPVRRESREEPVDAVIVGTGAGGAPLLARLAQAGLKVVALEAGN
HWDPAADFATDEREQNKLFWFDERLSAGADPLAFGRNNSGIGVGGSTLHYTAYVPRPQPD
DFRLYSDFGVGEDWPIGYGDLEPYFDELECFLGVSGPSPYPWGPARTPYPLAPMPLNAAA
QLMARGCAALGLRTSPAANAVLSAPYFQSGVGWRSPCTNRGFCQAGCTTGGKAGMDVTFI
PLALAHGAEVRSGAFVTRIETDRAGRVTGVVYVREGREERQRCRTLFLAAGAIETPRLLL
LNGLANQSGEVGRNFMAHPGLQLWGQFSEATRPFKGVPGSLISEDTHRPKDADFAGGYLL
QSIGVMPVTYATQTARGGGLWGEKLQSHMHGYNHTAGINILGECLPYAHNYLELSDEPDQ
RGLPKPRIHFSNGKNERRLRDHAEALMRRIWEAAGAQAVWTFERNAHTIGTCRMGADPKR
AVVDPEGRAFDVPNLYIIDNSVFPSALSVNPALTIMALSLRTADRFIERTQRGEY
Download sequence
Identical sequences Q7NJ28
251221.gll2004 gi|37521573|ref|NP_924950.1| NP_924950.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]