SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7NJK3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7NJK3
Domain Number 1 Region: 57-199
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 2.09e-47
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.0000121
Further Details:      
 
Domain Number 2 Region: 4-54
Classification Level Classification E-value
Superfamily UBA-like 7.07e-16
Family TS-N domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q7NJK3
Sequence length 219
Comment (sp|Q7NJK3|EFTS_GLOVI) Elongation factor Ts {ECO:0000255|HAMAP-Rule:MF_00050} KW=Complete proteome; Reference proteome OX=251221 OS=Gloeobacter violaceus (strain PCC 7421). GN=tsf OC=Gloeobacteraceae; Gloeobacter.
Sequence
MAEITSQMVMQLREKTQVGVLDCKKALAEAEGDLEKAIELLRKKGIMKAGKVKDKVATEG
LVGSYIHTGGRIGVLVEVNCQTDFVAKGEEFQQLVRDIAMQIAASPNVEFVSVDDVDQEV
KDRELAIEVQREDLLSKPEKIRAQIAQGRVDKLFKERALLEQPFIKDQSISVGELITQKI
AKIGENIKVRRFARFVLGEGLEKEEKNFAEEVAAQTGSV
Download sequence
Identical sequences Q7NJK3
gi|37521398|ref|NP_924775.1| 251221.gvip250 NP_924775.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]