SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q7NJS4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7NJS4
Domain Number 1 Region: 8-270
Classification Level Classification E-value
Superfamily Pentein 2.75e-51
Family Dimethylarginine dimethylaminohydrolase DDAH 0.027
Further Details:      
 
Weak hits

Sequence:  Q7NJS4
Domain Number - Region: 616-688
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 0.000563
Family Pyruvate oxidase and decarboxylase, middle domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q7NJS4
Sequence length 692
Comment (tr|Q7NJS4|Q7NJS4_GLOVI) Glr1758 protein {ECO:0000313|EMBL:BAC89699.1} KW=Complete proteome; Reference proteome OX=251221 OS=Gloeobacter violaceus (strain PCC 7421). GN=glr1758 OC=Gloeobacteraceae; Gloeobacter.
Sequence
MRSGLRYLMCSPTHYEVDYIINPWMEGNVHRSSREEAARQWEGLHKILDELADVQLVEPA
PGWPDMVFTANAGLVLDKNVVLSRFFHPERQGEEPHFREWFEAQGYVVCELPTKIAFEGA
GDALLDREGRWLWAGYGFRSSLESHPYLAKYLDIEVLSLRLVDERFYHLDTCFCPLSDGY
LLYYPPAFDDTSNRLIESRVSPDKRLVVGEVDAVNFACNAVNVERTVIVNQVTPGLAARL
ASCNFAVRETPLSEFLKAGGAAKCLTLRLTEPRTVEMPQVQVATRNVEMQGHLLDSALMT
EVIDLILKGGASFQILDFKVGQRRQDTSYTRLQVTAPTAETLESVLTQLIDRGAVLAEEA
VRDAELQAATQDGVAPQDFFVTSIYPTEVRLGGRWVVVAHQRMDGAIVVEPETGTARCAL
LRDIKAGERVVTGVEGIRTRHQKALPDREREEFSFMASGVSSERRVELVVEQVAWQLRRL
RTQGGKAVVVAGPVVIHTGGGAHLANLIREGYVQALLGGNAIAVHDIEQAFHGTSLGVDL
QRGVVIQGGHRHHLKTINLIRRCGSIAAAVEQGVLHSGIFYECVKAGVPFSLAGSIRDDG
PLPDTEMDLIQAQTDYARLIEGADLILMLSSMLHSIGVGNMTPAGVKLVCVDINPAVVTK
LADRGSVESVGVVTDVGLFLSLLVRQLHYLDH
Download sequence
Identical sequences Q7NJS4
251221.glr1758 NP_924704.1.44878 gi|37521327|ref|NP_924704.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]