SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7NKW3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7NKW3
Domain Number 1 Region: 182-391
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 7.85e-26
Family N-acetylmuramoyl-L-alanine amidase-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q7NKW3
Sequence length 401
Comment (tr|Q7NKW3|Q7NKW3_GLOVI) Gll1363 protein {ECO:0000313|EMBL:BAC89304.1} KW=Complete proteome; Reference proteome OX=251221 OS=Gloeobacter violaceus (strain PCC 7421). GN=gll1363 OC=Gloeobacteraceae; Gloeobacter.
Sequence
MGSGENDTLLQPEPEDITLAIPTNLSALFKDLVLLYARTEIQYPQLKAVTLAQWILESGW
GESNLAKNHYNFGGLKWRTEMTGFATRILYQANDGPDYYCQFAGLERFIRGYWRFIDRSP
YTGWEERTDSGEEFIRFVGPVYSPSPGYVDRVLALVDEAQILLDNAAEPVIAPIESPSLR
GTVVLDPGHGGTRKIGGSSPNNAISASGIKEKTMTLEIALLIRDALQQIAAQNGYDLRVV
LTRTADVNVGIAERANLASVERADLFLSIHFNGFNKQTSGVETYIRARTNGNVNFEEDEA
FAWRIQGAVLGALRTYLPGTRDRGVKEDTASGGGVLGVLDDRALGNSSQEYPCRACLVEI
EFIDVPRVDRLLNTDAQARQVRGAIAEAIAAAMVEDLQAAR
Download sequence
Identical sequences Q7NKW3
NP_924309.1.44878 251221.gll1363 gi|37520932|ref|NP_924309.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]