SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7NMQ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7NMQ9
Domain Number 1 Region: 1-237
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.82e-72
Family Histidine biosynthesis enzymes 0.0000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q7NMQ9
Sequence length 255
Comment (sp|Q7NMQ9|HIS4_GLOVI) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase {ECO:0000255|HAMAP-Rule:MF_01014} KW=Complete proteome; Reference proteome OX=251221 OS=Gloeobacter violaceus (strain PCC 7421). GN=glr0706; OC=Gloeobacteraceae; Gloeobacter.
Sequence
MDIIPAIDILDGRCVRLYQGNYQLAETYGEDPVAVACNWAKLGAPRLHVVDLDGARQGMP
VHLDALEAIVTQVPCPVQFGGGLRSIEAVSAVLDRGVDRVILGTAAVENPALIRECCERF
GGRIAVGLDARGGQVAVRGWRETSEVEVTELAGEMEKLGVSAIVYTDILKDGTLTGPNLV
ELQRLTDAVKVPIIASGGVGTLADVLYLLALEPRGLQGVIIGRALYTGDVDLAEALRAAG
PSRWQDLPPDDVAFA
Download sequence
Identical sequences Q7NMQ9
gi|37520275|ref|NP_923652.1| 251221.gvip072 NP_923652.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]