SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7NPI4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7NPI4
Domain Number 1 Region: 8-430
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.16e-135
Family GABA-aminotransferase-like 0.000000000019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q7NPI4
Sequence length 432
Comment (sp|Q7NPI4|GSA_GLOVI) Glutamate-1-semialdehyde aminotransferase {ECO:0000255|HAMAP-Rule:MF_00375} KW=Complete proteome; Reference proteome OX=251221 OS=Gloeobacter violaceus (strain PCC 7421). GN=glr0071; OC=Gloeobacteraceae; Gloeobacter.
Sequence
MVTSAFQTAQSHRLFAEAQQLMPGGVNSPVRAFKSVGSEPVFIERAEGAYLWDVDGNRYI
EYINTWGPSIVGHSHPEVISALREALPKGTSYGAPTRLENQMARTVIDAIPAVEMVRFVN
SGTEATMSALRLARAFTGREKIIKFEGCYHGHADMLLVQAGSGVATLGLPDSPGVPKSTT
AATLTAPYNDLAAVEALFKQYPSDVAGLILEPVVGNAGCLVPEIGFLEGLRDLTHAHGTV
LIFDEVMTGFRLSYGGAQARYGIEPDLTCLGKIIGGGLPVGAYAGRREIMQMVAPAGPMY
QAGTLSGNPLAMTAGIKTLEILQRPGTYERLEGLSARLADGLLAAAREAGHAATGNRVGA
MFTLFFTEGPVRNFADAKRSDLQKFARFHRGMLERGVYLAPSQFEAGFMSLAHTEEDIDY
TVAAARTVLAAL
Download sequence
Identical sequences Q7NPI4
NP_923017.1.44878 251221.gvip005 gi|37519640|ref|NP_923017.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]