SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7NVI8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7NVI8
Domain Number 1 Region: 4-258
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 7.97e-24
Family Epoxide hydrolase 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q7NVI8
Sequence length 267
Comment (tr|Q7NVI8|Q7NVI8_CHRVO) Probable hydrolase {ECO:0000313|EMBL:AAQ60026.1} KW=Complete proteome; Reference proteome OX=243365 OS=NBRC 12614 / NCIMB 9131 / NCTC 9757). GN=CV_2354 OC=Chromobacteriaceae; Chromobacterium.
Sequence
MREAIHFAHANSFPGSVYGKMLGKLAEGRDVGYLDTIGHDPDYPVTDCWPYLVDESVRFI
ETRYRGPVVGVGHSLGGFLMFYAALKRPDLFRAIIILDSPLMGPSRSFGIWLAKRLGFIQ
RVTPGGDTLRRRDNWATVEMAHDYFARKPKFARFDPDCLADYALHGTQDDGKGGRRLKFR
PQVEHDIYATLPHDFPRHKGKLKVPAALLAGEASDVLRDGDLAFMRKHFSVKVGKQAGSH
LFPLEKPLETAASIERLLAQLEDRGWA
Download sequence
Identical sequences Q7NVI8
243365.CV_2354 WP_011135901.1.48671 gi|34497809|ref|NP_902024.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]