SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7PW78 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7PW78
Domain Number 1 Region: 819-904
Classification Level Classification E-value
Superfamily DEATH domain 1.65e-20
Family DEATH domain, DD 0.0004
Further Details:      
 
Domain Number 2 Region: 119-207
Classification Level Classification E-value
Superfamily Immunoglobulin 8.94e-17
Family I set domains 0.029
Further Details:      
 
Domain Number 3 Region: 207-256
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000235
Family TSP-1 type 1 repeat 0.00088
Further Details:      
 
Domain Number 4 Region: 265-311
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000471
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Weak hits

Sequence:  Q7PW78
Domain Number - Region: 14-114
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0456
Family I set domains 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q7PW78
Sequence length 912
Comment (tr|Q7PW78|Q7PW78_ANOGA) AGAP009061-PA {ECO:0000313|EMBL:EAA14755.4} KW=Complete proteome; Reference proteome OX=7165 OS=Anopheles gambiae (African malaria mosquito). GN=AgaP_AGAP009061 OC=Culicidae; Anophelinae; Anopheles.
Sequence
IESFGAGNDGTPLPVFLVEPKGAYVMKNRPAKLYCKASHALQISFKCSGSTKPPPTEKEH
HTDPHSGVQLQEATATITRELVDEFFGKGPFKCECRAYSSRGHVKTQPVTIQVATIKKQI
SISPKIVRVATGGRAELNCIANATPAAKVVWLKNSVPVHANPPFVLLTENALLIARVEIQ
DMANYTCVAENIAGKRVSDPVPITVYVDGGWSSWGPWTDCKCPGHGKQGQKRTRVCNSPV
PMNNGAPCKGASTESTPDCLPCSAGRWSSWSEWSECGPDCTQIRQRSCVAFAIDSGTIVN
CAGKSQQSIKCTGGLCNYTAQDSNWSVYLWVTLVAAFCLGVVFAVSKFLRRKKTIPAYNL
APAAASSSSVFAAPPARQQPARAGSHRTRTASSPVPIAASANPSDRGPQIVIAFATVQFR
APLRRAPFCNLWAPSIAVPKRSGRLPHGGAYLTDWSPKLTHHPGQTRAAKTAKKGDRAQN
GSRSRAPALFADHQTDPPERPSSVTHATLTPAGALLRLATYSTALLIPEGAIPKHQRHSV
ALSIVRDDKHHVPVPTGPRSTYLSPVVFCGPVDTKVNKPIVMQLPHCAENLSDWAFSLYS
APDNVTPWCKVVTIGEETLNTPALVQIDKRYAYVLTETFGKYVLVGESATDIQERVACKR
LRLFICGPSTVPEFSDVSLRVYIVEDNPGAEERCRHCEQEIGGVLLGRSTVLHFADVGQA
GLNIDLQCVGGWRAKSSSERQTIPFSHVWNSACTALHCSFTLCRTEHDKCDFKIVVQASQ
DVPQGLDERLTAIGVPATLSISSVGSGDHNTNLVATDRFRLSKDVKRKLCRCLDPPTQKR
NDWRMLAAHLNVDRYLTYFATRPSPTDQILDLWECRNRDLNALQQLIEICRTMERPDAVA
ILEQIQPAAPWV
Download sequence
Identical sequences Q7PW78
AGAP009061-PA 7165.AGAP009061-PA AGAP009061-PA|hypothetical XP_319812.4.40869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]