SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7Q068 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7Q068
Domain Number 1 Region: 277-340
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000599
Family Transcription factor E/IIe-alpha, N-terminal domain 0.09
Further Details:      
 
Domain Number 2 Region: 37-301
Classification Level Classification E-value
Superfamily ARM repeat 0.0000414
Family Armadillo repeat 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q7Q068
Sequence length 385
Comment (sp|Q7Q068|EIF3M_ANOGA) Eukaryotic translation initiation factor 3 subunit M {ECO:0000255|HAMAP-Rule:MF_03012} KW=Complete proteome; Reference proteome OX=7165 OS=Anopheles gambiae (African malaria mosquito). GN=AGAP012281; OC=Culicidae; Anophelinae; Anopheles.
Sequence
MQGPAVFIDAEIDDQAQELRQFLKGLGAEISEEKSTKGIEDDLHKIIGVCDVCFKDNTHS
PEEIDAVLNSIVSIIVSIPLERGENLILSFCDKMTKAKETSLARVCLQSLWRLFSNLEVT
SPLRYHVYYHLVQVAKQVNQVKEVFTGVEQLKAQFAQCPPSNEQMQKLYRLLHDVLKDSN
SELASKVMIELLGTYTAENASYAREDAMKCIVTALADPNTFLLDPLLSLKPVRFLEGELI
HDLLSVFVSEKLPSYLEFYKNHKEFVNSQGLNHEQNIKKMRLLSFMQLAESNSEMTFQQL
QDELQIKEEEVEPFIIEVLKTKLVRARMDQRARKVHISSTMHRTFGRPQWQQLRDLLLSW
KSNLTLVQENINTVSAAQMELAQRQ
Download sequence
Identical sequences A0A182KSP2 Q7Q068
XP_320254.2.40869 AGAP012281-PA 7165.AGAP012281-PA AGAP012281-PA|Eukaryotic

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]