SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7Q6T5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7Q6T5
Domain Number 1 Region: 274-315
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000723
Family EGF-type module 0.0058
Further Details:      
 
Domain Number 2 Region: 244-280
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000594
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q7Q6T5
Sequence length 452
Comment (tr|Q7Q6T5|Q7Q6T5_ANOGA) AGAP005682-PA {ECO:0000313|EMBL:EAA11245.4} KW=Complete proteome; Reference proteome OX=7165 OS=Anopheles gambiae (African malaria mosquito). GN=AgaP_AGAP005682 OC=Culicidae; Anophelinae; Anopheles.
Sequence
MGRKLAHHLVLVGTLLLLAVESFSRAQAAANDYPAQQHQHLRNQQHHQHQHHHRHRTAEP
SRSRNQTSLNYALISGPGSVGNGGSDYRPPYQYPGTTGQQHWGNHHGNQPQHHHRETPPQ
HRRHHRGQAHPSHSQPSSPPGAAGWRRTSGNGGVPAARPVTRMLTRSGTVGSARHNNSTS
GKNVCTVHVYRKSVIKTYQGAPCRDPANCYGLRTYSAPVATREVCCRGWETTTTVADGCF
KPICQTPCRNGGRCTAPDRCTCPAGFTGKYCELDVNECKEHKPCDQTCYNTEGSYYCTCR
DGFMLQSDRQTCKKIGKLGHRGTPGAMEEKYATLNETNDLATEARDMENDLDVDYDSLDI
RLRKLEQLMASRDDRQELTKKVQYTMDAVSVLKSQVARLVSDFVYHFCFYNTELTLFCGS
CFYLSEPTTISTGGLWKSGSLGKPERMERTCF
Download sequence
Identical sequences Q7Q6T5
7165.AGAP005682-PA XP_315695.4.40869 AGAP005682-PA AGAP005682-PA|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]