SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7Q822 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7Q822
Domain Number 1 Region: 151-253
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.66e-23
Family Voltage-gated potassium channels 0.0034
Further Details:      
 
Domain Number 2 Region: 76-136
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.31e-17
Family Voltage-gated potassium channels 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q7Q822
Sequence length 338
Comment (tr|Q7Q822|Q7Q822_ANOGA) Potassium channel, subfamily K {ECO:0000313|VectorBase:AGAP004896-PB} KW=Complete proteome; Reference proteome OX=7165 OS=Anopheles gambiae (African malaria mosquito). GN=AgaP_AGAP004896 OC=Culicidae; Anophelinae; Anopheles.
Sequence
IFREFERPAEVNRIQGLRKLLVQHRQEFIYSIVNNTDVQNLDRLLTLELEKYEQVVQDAA
QGGILIDANENFPVAVEKWSMLQAVFFASTVITTIGYGNIVPVTLGGRVFCMLFALIGIP
FTLTVIADWGRLFATAVSILAKNIPDLPLATFTVSRKWLYAVGAVGFLGVYLAAGTGLLL
LWEEDWDFFDGYYFCFITMTTIGFGDLVPSKPNYMLLCTLYILVGLALTSTIIELVRRQY
AQSWQKLQALSGPLAETLRRLGESAGTGIDVTALHNDLRRVLTVVSMPRRHGNKKAQAKE
MAALEAITNAILQDIKEKQNSQEGVPKMVQIVIYESSV
Download sequence
Identical sequences Q7Q822
AGAP004896-PB|hypothetical AGAP004896-PB XP_314981.2.40869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]