SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7Q9F4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7Q9F4
Domain Number 1 Region: 160-304
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 5.36e-27
Family Toll/Interleukin receptor TIR domain 0.0022
Further Details:      
 
Domain Number 2 Region: 25-120
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000135
Family DEATH domain, DD 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q7Q9F4
Sequence length 462
Comment (tr|Q7Q9F4|Q7Q9F4_ANOGA) TOLL pathway signalling {ECO:0000313|VectorBase:AGAP005252-PA} KW=Complete proteome; Reference proteome OX=7165 OS=Anopheles gambiae (African malaria mosquito). GN=AgaP_AGAP005252 OC=Culicidae; Anophelinae; Anopheles.
Sequence
MLDNPVKPTEVSVKNRIDLAVVPLEALSSRTRELVAELLNHKRIFTSEDGYFRDWRGVFD
VIGIPKSFLPLVSTNPNPTRCLLDLWQSETHQCKREPNLAELQCVLGCIDRWDILDDTSK
MFERDAEQFLLREQKRAAQRGRETEATESKVSADSDIITRDDTSDHKQQYDAFILFADAD
IEFASKMVDKLEARGLQLCLRDRDILGGSNFEHEVISRLISERCRRVVVIISKAFLASPL
NDFTVTFAQALQIEQKARKVIPCVYDRCELPPHLRYTCRLDYQRSQNLYNFWDKLAESIR
DTPRKVGLEVSGRELPAPQKPPVHSKPVELIGPPQPLPKVVVEQPPLVVKLPRAAEQDSR
TGSLKKSHSFWDIFSNFGHKKDKLNGSTSQLNLNEMATPLPSPKKVGSSPLALIRRDKKQ
PSAASASSAPSACPLDLPPVIKPVKSKKKWYKPGSRKLASAV
Download sequence
Identical sequences Q7Q9F4
7165.AGAP005252-PA AGAP005252-PA|TOLL XP_314167.4.40869 AGAP005252-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]