SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7QJ06 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7QJ06
Domain Number 1 Region: 177-254
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000225
Family DEATH domain, DD 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q7QJ06
Sequence length 255
Comment (tr|Q7QJ06|Q7QJ06_ANOGA) IMD pathway signalling Fas-Associated Death Domain (FADD) {ECO:0000313|VectorBase:AGAP007173-PA} KW=Complete proteome; Reference proteome OX=7165 OS=Anopheles gambiae (African malaria mosquito). GN=AgaP_AGAP007173 OC=Culicidae; Anophelinae; Anopheles.
Sequence
MERISVQDHRAVYERLCKDYLNLKLLAQNACHGPERLERCKQSVRQDIHSCRKLSRITQF
EQLVALMEQRNLVSLLKPDLIERFVLALDTKEVGGALTSYRNVLRSHYEPVRRFYLEDLR
HRDRRTLLEKEVERIKLQESTEPPAVTPRPPTATTNAKRDAYLRQREGIYSLLQLEIGKS
WKVFGRFLNVPAGELDEIEERNRQDLKTRIYETLEWAEMQYDDAALDQYVGVLLKALESS
RRKDLKRKIETMLQR
Download sequence
Identical sequences Q7QJ06
AGAP007173-PA 7165.AGAP007173-PA AGAP007173-PA|IMD XP_308597.4.40869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]