SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7R7N9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7R7N9
Domain Number 1 Region: 148-188
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000161
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q7R7N9
Sequence length 213
Comment (tr|Q7R7N9|Q7R7N9_PLAYO) MSP4/5 {ECO:0000313|EMBL:EAA20031.1} KW=Complete proteome; Reference proteome OX=73239 OS=Plasmodium yoelii yoelii. GN=PY07543 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
MKITNYLSIINLFVVLLISFKNVHEISLINTKKYQRNIFCAKRILGDPPSANPSTSLNQN
EDNHNSNPDANKGNTNKSDKLNGDNIPNSQSKSENTNLSESPKTGTASNPPQPEPSVQPG
NTNGDSQNSIHSDDEEEDDEDEDDDEEDCSVNNGGCGENLLCEKMESGIIKCSCPSGYKL
NGTSCIELLSAHSVNYCFCGILIILIILVSMIY
Download sequence
Identical sequences Q7R7N9 Q9NJW2 V7PC04
2806.m00032|PY07543|PY07543|MSP4/5|p_yoelii|chr_0|MALPY02806|2806 XP_728466.1.76580 73239.Q7R7N9 gi|82794512|ref|XP_728466.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]