SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7R866 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7R866
Domain Number 1 Region: 4-137
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.12e-31
Family spliceosomal protein U5-15Kd 0.00000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q7R866
Sequence length 142
Comment (tr|Q7R866|Q7R866_PLAYO) Drosophila melanogaster RE13747p {ECO:0000313|EMBL:EAA19764.1} KW=Complete proteome; Reference proteome OX=73239 OS=Plasmodium yoelii yoelii. GN=PY07357 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
MSFMLQHLNSGWAVDQAIVNEDERLVCIRFGHDYDPDCMKMDELLYKVADDIKNFCVIYL
VDITEVPDFNTMYELYDPVSVMFFYRNKHMMIDLGTGNNNKINWPMNNKQEFIDIVETIF
RGARKGRGLVISPKDYSTKYKY
Download sequence
Identical sequences A0A077TVB6 A0A077XKH3 A0A077YC24 A0A0Z0B3C7 A0A1C6YPW4 Q7R866 V7PS38
gi|82793842|ref|XP_728199.1| 2687.m00028|PY07357|PY07357|Drosophila PBANKA_144620 PCAS_144840 XP_008622770.1.22292 XP_728199.1.76580 XP_739362.2.12432 73239.Q7R866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]