SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7RAT4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7RAT4
Domain Number 1 Region: 310-350
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000186
Family Merozoite surface protein 1 (MSP-1) 0.016
Further Details:      
 
Domain Number 2 Region: 263-296
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000708
Family EGF-type module 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q7RAT4
Sequence length 371
Comment (tr|Q7RAT4|Q7RAT4_PLAYO) Merozoite surface protein {ECO:0000313|EMBL:EAA18630.1} KW=Complete proteome; Reference proteome OX=73239 OS=Plasmodium yoelii yoelii. GN=PY06415 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
VLIRKERKRKSKSDFSKGEPENKEHEIINLYDDVQELLGPDEMNMLDKYSILGIDDCSNE
NENNKIISEYDLKAMKSVLLYKNRISRASINNLDDVKTVFKRCFNKDDPELSKSYEQIQN
QVANEGTTIIDYLSNYISNIYIKINDEFVKNEEFQLSKYIPELEIINYVLYNGPKEIGNK
IKNELIEINNLIISESLTSIYSSVVSGLNINCKIKDDLITILNLANGKYFKVNFSSQATM
IIPEQYSHESEHMKKISEYFIEKNRVCKNENCPINSNCYVIDSVETCRCIPGFSKNEESE
NLECLINESTSCENNNGGCDVNANCILLEDKIMCECNNKFNGDGIYCSSAIYYGMNVFIF
FLISIVCIYIM
Download sequence
Identical sequences Q7RAT4
2177.m00021|PY06415|PY06415|merozoite gi|82705673|ref|XP_727065.1| XP_727065.1.76580 73239.Q7RAT4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]