SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7RRN2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7RRN2
Domain Number 1 Region: 79-217
Classification Level Classification E-value
Superfamily MTH1598-like 1.12e-45
Family MTH1598-like 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q7RRN2
Sequence length 217
Comment (tr|Q7RRN2|Q7RRN2_PLAYO) Drosophila melanogaster CG6353 gene product {ECO:0000313|EMBL:EAA17858.1} KW=Complete proteome; Reference proteome OX=73239 OS=Plasmodium yoelii yoelii. GN=PY00687 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
MGDFPNNQITSLPQRNRRRINRNYAHEESKSTCTNEIEENEATNDENVDKNADKNANKNA
DKNMMSDIEICNINLNKNYKYEYLDHTADIILHSYGNNLKEAFESVCVALFNYMCDLKNV
ELKMKRKISIKGDDLDDLLFKFLVEFHFLYGNEYFICKTINIIVFDIEQFYIEAYGYGEL
FSTYKHECGTEIKAITKHELKIVSNYNSCEVFVLVDI
Download sequence
Identical sequences A0A077YEV0 Q7RRN2
gi|82596517|ref|XP_726293.1| XP_726293.1.76580 189.m00113|PY00687|PY00687|Drosophila 73239.Q7RRN2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]