SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7RTS1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7RTS1
Domain Number 1 Region: 75-135
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.97e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q7RTS1
Sequence length 189
Comment (sp|Q7RTS1|BHA15_HUMAN) Muscle, intestine and stomach expression 1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=BHLHA15; OC=Catarrhini; Hominidae; Homo.
Sequence
MKTKNRPPRRRAPVQDTEATPGEGTPDGSLPNPGPEPAKGLRSRPARAAARAPGEGRRRR
PGPSGPGGRRDSSIQRRLESNERERQRMHKLNNAFQALREVIPHVRADKKLSKIETLTLA
KNYIKSLTATILTMSSSRLPGLEGPGPKLYQHYQQQQQVAGGALGATEAQPQGHLQRYST
QIHSFREGT
Download sequence
Identical sequences Q7RTS1
9606.ENSP00000326391 ENSP00000326391 gi|29126247|ref|NP_803238.1| NP_803238.1.87134 NP_803238.1.92137 ENSP00000326391 ENSP00000476312 ENSP00000326391 ENSP00000476312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]