SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7RTU1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7RTU1
Domain Number 1 Region: 82-133
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000942
Family HLH, helix-loop-helix DNA-binding domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q7RTU1
Sequence length 214
Comment (sp|Q7RTU1|TCF23_HUMAN) Class A basic helix-loop-helix protein 24 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=TCF23; OC=Catarrhini; Hominidae; Homo.
Sequence
MSQRKARGPPAMPGVGHSQTQAKARLLPGADRKRSRLSRTRQDPWEERSWSNQRWSRATP
GPRGTRAGGLALGRSEASPENAARERSRVRTLRQAFLALQAALPAVPPDTKLSKLDVLVL
AASYIAHLTRTLGHELPGPAWPPFLRGLRYLHPLKKWPMRSRLYAGGLGYSDLDSTTAST
PSQRTRDAEVGSQVPGEADALLSTTPLSPALGDK
Download sequence
Identical sequences H2QHL7 Q7RTU1
ENSP00000296096 9598.ENSPTRP00000020196 9606.ENSP00000296096 gi|75677394|ref|NP_786951.1| NP_786951.1.87134 NP_786951.1.92137 XP_001154318.1.37143 XP_003827134.1.60992 ENSPTRP00000020196 ENSP00000296096 ENSPTRP00000020196 ENSP00000296096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]