SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7RTU3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7RTU3
Domain Number 1 Region: 83-160
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000249
Family HLH, helix-loop-helix DNA-binding domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q7RTU3
Sequence length 272
Comment (sp|Q7RTU3|OLIG3_HUMAN) Class E basic helix-loop-helix protein 20 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=OLIG3; OC=Catarrhini; Hominidae; Homo.
Sequence
MNSDSSSVSSRASSPDMDEMYLRDHHHRHHHHQESRLNSVSSTQGDMMQKMPGESLSRAG
AKAAGESSKYKIKKQLSEQDLQQLRLKINGRERKRMHDLNLAMDGLREVMPYAHGPSVRK
LSKIATLLLARNYILMLTSSLEEMKRLVGEIYGGHHSAFHCGTVGHSAGHPAHAANSVHP
VHPILGGALSSGNASSPLSAASLPAIGTIRPPHSLLKAPSTPPALQLGSGFQHWAGLPCP
CTICQMPPPPHLSALSTANMARLSAESKDLLK
Download sequence
Identical sequences Q7RTU3
9606.ENSP00000356708 NP_786923.1.87134 NP_786923.1.92137 ENSP00000356708 ENSP00000356708 ENSP00000356708 gi|28411948|ref|NP_786923.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]