SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7SZA7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7SZA7
Domain Number 1 Region: 77-191
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.62e-31
Family Glutathione S-transferase (GST), C-terminal domain 0.0000922
Further Details:      
 
Domain Number 2 Region: 2-76
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.5e-20
Family Glutathione S-transferase (GST), N-terminal domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q7SZA7
Sequence length 197
Comment (tr|Q7SZA7|Q7SZA7_XENLA) XlGSTS1-1 protein {ECO:0000313|EMBL:AAH53774.1} OX=8355 OS=Xenopus laevis (African clawed frog). GN=XlGSTS1-1 OC=Xenopus.
Sequence
MPSYKLIYFNLEGRGEILRYLFSYSNIDFEDRRVEFADWPALKPTIPYGQLPVVEIDGVI
YNQSLAIGRYLAKKAGLTGKSELDEIRVDALIDTIDDFFSKFPWMDTEKAKKEFMEKSSP
QLLAYLEKTLGNNPWFVGDSATWADFFWDTCADSFESYVPGFAKDYPKLLALKERVKAIP
TIAAWIKKRPKKIPVKH
Download sequence
Identical sequences Q7SZA7
NP_001079730.1.7800 gi|148232276|ref|NP_001079730| gi|32450087|gb|AAH53774|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]