SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7T0U3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7T0U3
Domain Number 1 Region: 100-247
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.71e-35
Family Glutathione S-transferase (GST), C-terminal domain 0.00000303
Further Details:      
 
Domain Number 2 Region: 28-98
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.92e-16
Family Glutathione S-transferase (GST), N-terminal domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q7T0U3
Sequence length 250
Comment (tr|Q7T0U3|Q7T0U3_XENLA) Chloride intracellular channel protein {ECO:0000256|RuleBase:RU362009} OX=8355 OS=Xenopus laevis (African clawed frog). GN=clic6 OC=Xenopus.
Sequence
MTDSAPTNGEERDPDIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRKP
ADLHNLAPGTHPPFLTFNGEVKTDVNKIEEFLEETLAPPRYPRLAAKHRESNSAGIDVFS
RFSAYIKNTKQQDNAALQKGLTKALKKLDDYLNTPLPEEIDANSREEERVSKRMFLDGDE
FTLADCNLLPKLHVVKIVAKKYRNYEISSDMSGIWRYLKNAYARDEFTNTCAADKETELA
YADVAKRLSK
Download sequence
Identical sequences Q7T0U3
gi|148232178|ref|NP_001080333| gi|33416790|gb|AAH56036| NP_001080333.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]