SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7T2D0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7T2D0
Domain Number 1 Region: 99-263
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.28e-42
Family Ypt/Rab-GAP domain of gyp1p 0.0041
Further Details:      
 
Domain Number 2 Region: 243-358
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.86e-23
Family Ypt/Rab-GAP domain of gyp1p 0.013
Further Details:      
 
Domain Number 3 Region: 481-546
Classification Level Classification E-value
Superfamily SH3-domain 8.53e-19
Family SH3-domain 0.0008
Further Details:      
 
Domain Number 4 Region: 558-599,633-721
Classification Level Classification E-value
Superfamily RUN domain-like 0.00000000000000288
Family RUN domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q7T2D0
Sequence length 755
Comment (sp|Q7T2D0|SGSM3_DANRE) RUN and TBC1 domain-containing protein 3 KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=rutbc3 OC=Cyprinidae; Danio.
Sequence
MSGSYTPAPGGPFSALTPSMWPQDILAKYCQKDPGTEVELQYDEFGFRIDSEDGVETRKW
LCGDGAPQREDPQQRLRWQAHLEFTHNHTVGDLTWDKITPTLARSDRLRSLVLGGIPHSM
RPQLWMRLSGALQKKRTSDISYREIVKNSSNDDTTAAKQIEKDLLRTMPTNACFNTLTSV
GVPKLRRVLRGLAWLYPDIGYCQGTGMVVSCLLLFLEEEDALWMMCALIEDLLPPSYFSS
TLLGVQTDQRVLRQLIVQYLPRLDKLLQEHDIELSLITLHWFLTAFASVVDIRILLRIWD
LLFYEGSMVLFQVTLGMLKIKEDELVSSENSASIFNTLSDLPSQLEDGAAVLGEAVRLAG
SLSQENLDTHRHKHLAYILAEQAQLNSNNSHSLNTNLNKVVRRQNMRRKSTLSSLLWGED
EVEALKAKNIKQTELVAALREAINRTAEHFHCLDPRNCSTDLTPDYSMESHQRDHENFLV
VSRNRRRRAKALLDFERHDDDELGFRKNDIITIISQKDEHCWVGELNGLRGWFPAKFVEI
LDERSKEYSLAGDDTVTEAVNDLVRGSLCPALKAIFQHGLKKPSILGGPCHPWLFIEEAA
SKEVERDFNSVYSRLVLCKTYRLDEDGKVLTPEELLYRAVQSVNMSHDTAHVQMDVKFRS
LICVGLNEQVLHLWLEVLCSSMSAVEKWYHPWSFLRSPGWVQIKCELRVLSKFAFSLSQD
CELPTKKEEKEQRPLKEGVQDMLVKHHLFSWDIDG
Download sequence
Identical sequences B2GRW4 Q7T2D0
ENSDARP00000017428 7955.ENSDARP00000017428 NP_998495.1.45394 ENSDARP00000017428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]