SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7TMI6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7TMI6
Domain Number 1 Region: 36-127
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.07e-36
Family SCAN domain 0.0000395
Further Details:      
 
Domain Number 2 Region: 470-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.6e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 580-637
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.44e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 626-678
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.51e-18
Family Classic zinc finger, C2H2 0.0024
Further Details:      
 
Domain Number 5 Region: 433-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.55e-17
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 6 Region: 375-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000121
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 7 Region: 516-556
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000199
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 8 Region: 213-268
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000235
Family KRAB domain (Kruppel-associated box) 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q7TMI6
Sequence length 680
Comment (tr|Q7TMI6|Q7TMI6_MOUSE) Zinc finger protein 263 {ECO:0000313|EMBL:AAH56222.1} OX=10090 OS=Mus musculus (Mouse). GN=Zfp263 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MTMAAGPSSQEPEGLLIVKLEEDCAWSHEVPPPEPEPSPEASHLRFRRFRFQDAPGPREA
LSRLQELCRGWLRPEMRTKEQILELLVLEQFLTILPQEIQSRVQELRPESGEEAVTLVER
MQKELGKLRQQVTNQGRGAEVLLEEPLPLETAGESPSFKLEPMETERSPGPRLQELLDPS
PQRDSQAVKERALSAPWLSLFPPEGNVEDKDMTGTQLPESLEDMAMYISQEWDHQDPSKR
ALSRYMVQDSYENSGTLESSIPSQEVSSTHVEQGEKLWDSSVQTCKEGMNPRNPVPGVEK
FENQERNVESVSPESTHPPVLLPGQARREVPWSPEQGRLDDREGHWECPPEDKIEESLVG
TPSCKGLVQAKEQPKKLHLCALCGKNFSNNSNLIRHQRIHAAEKLCMDVECGEVFGGHPH
FLSLHRTHIGEEAHKCLECGKCFSQNTHLTRHQRTHTGEKPSQCNACGKSFSCNSNLNRH
QRTHTGEKPYKCPECGEIFAHSSNLLRHQRIHTGERPYRCSECGKSFSRSSHLVIHERTH
EKERLDPFPECGQGMNDSAPFLTNHRVEKKLFECSTCGKSFRQGMHLTRHQRTHTGEKPY
KCILCGENFSHRSNLIRHQRIHTGEKPYTCHECGDSFSHSSNRIRHLRTHTGERPYKCSE
CGESFSRSSRLTSHQRTHTG
Download sequence
Identical sequences Q7TMI6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]