SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7TP57 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7TP57
Domain Number 1 Region: 777-984
Classification Level Classification E-value
Superfamily p53-like transcription factors 7.54e-77
Family STAT DNA-binding domain 0.0000000126
Further Details:      
 
Domain Number 2 Region: 29-227
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.33e-74
Family STAT DNA-binding domain 0.000000623
Further Details:      
 
Domain Number 3 Region: 596-777
Classification Level Classification E-value
Superfamily STAT 4.32e-60
Family STAT 0.0000000284
Further Details:      
 
Domain Number 4 Region: 463-583
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 2.22e-44
Family Transcription factor STAT-4 N-domain 0.0000203
Further Details:      
 
Domain Number 5 Region: 985-1126
Classification Level Classification E-value
Superfamily SH2 domain 5.39e-44
Family SH2 domain 0.000000107
Further Details:      
 
Domain Number 6 Region: 228-351
Classification Level Classification E-value
Superfamily SH2 domain 2.29e-42
Family SH2 domain 0.00000437
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q7TP57
Sequence length 1165
Comment (tr|Q7TP57|Q7TP57_RAT) Signal transducer and activator of transcription {ECO:0000256|RuleBase:RU046415} OX=10116 OS=Rattus norvegicus (Rat). GN= OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MTYEGDPIPAQRVHLLERATFLIYNLFKKLLIKLPELNYQVKVKASIDNNRRFVLCGTHI
KAMSSEESSNGSLSVEFRHLGCHMVTEELHSITFETQICLYGLTINLETSSLPVVMISNV
SQLPNAWASIIWYNVSTNDSQNLVFFNNPPSVTLGQLLEVMSWQFSSYVGRGLNSDQLNM
LAEKLTVQSNYSDGHLTWAKFCKEHLPGKTFTFWTWLEAILDLIKKHILPLWIDGYIMGF
VSKEKERLLLKDKMPGTFLLRFSESHLGGITFTWVDQSENGEVRFHSVEPYNKARLSALP
FADILRDYKVIMAENIPENPLKYLYPDIPKDKAFGKHYSSQPCEVPRKHVVRLFPAAASL
PPQFANRVAAAPPVANLWFLWKSEEGTRYPGTGVGNRHDGTANPTPVLCKGKFFLTAELR
PIISTLFHPLSRRHSVHAQAYNCLCVWSLVLTPQSAPGDSPRMSQWYELQQLDSKFLEQV
HQLYDDSFPMEIRQYLAQWLEKQDWEHAAYDVSFATIRFHDLLSQLDDQYSRFSLENNFL
LQHNIRKSKRNLQDNFQEDPVQMSMIIHNCLKEERKILENAQRFNQAQEGNIQNTVMLDK
QKELDSKVRNVKDQVMCIEHEIKTLEDLQDEYDFKCKTSQNRESEANGVAKSDQKQEQLL
LHKMFLMLDNKRKEIIHKIRELLNSIELTQNTLINDELVEWKRRQQSACIGGPPNACLDQ
LQSWFTIVAESLQQVRQQLKKLEELEQKFTYEQDPITKNKQVLSDRTFVLFQQLIQRLLV
KLQELNYNLKVKVSFDKDVNEKNTVKGSKHFKDLCLALYRFRKFNILGTHTKVMNMEEST
NGSLAAEFRHLQLKEQKNAGNRTNETTSLPVVVISNVSQLPSGWASILWYNMLVTEPRNL
SFFLNPPCAWWSQLSEVLSWQFSSVTKRGLNADQLSMLGEKLLGPNAGPDGLIPWTRFCK
ENINDKNFSFWPWIDTILELIKKHLLCLWNDGCIMGFISKERERALLKDQQPGTFLLRFS
ESSREGAITFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIPENPL
KYLYPNIDKDHAFGKYYSRPKEAPEPMELDDPKRTGYIKTELISVSEVHPSRLQSTENLL
PMSPEEFDEMSKIVGSEFDSMMSAV
Download sequence
Identical sequences Q7TP57
10116.ENSRNOP00000049797 ENSRNOP00000020032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]