SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7TPL8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7TPL8
Domain Number 1 Region: 535-592
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-23
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 2 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.35e-23
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 3 Region: 451-508
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.34e-21
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 4 Region: 577-629
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.05e-18
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 5 Region: 619-664
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000228
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 6 Region: 498-530
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000128
Family Classic zinc finger, C2H2 0.0099
Further Details:      
 
Domain Number 7 Region: 248-296
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000031
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Weak hits

Sequence:  Q7TPL8
Domain Number - Region: 373-419
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00013
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Domain Number - Region: 325-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0193
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q7TPL8
Sequence length 668
Comment (tr|Q7TPL8|Q7TPL8_MOUSE) Uncharacterized protein {ECO:0000313|EMBL:AAH55299.1} OX=10090 OS=Mus musculus (Mouse). GN=A430033K04Rik OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MGLVSFEDVAVDFTWQEWQELDAAQRTLYRDVMLENYRSLVWLGHCLAKPELISKLEEGF
EPWGVAEATEQCLPGVRKWSAPVEKGQQSQEKYLRQVKIIKKNTPDEDKVEVENTYNVDS
NCISNMTLKNEVCSRVFFQELVNPLLDVPLPTEAGERQSTEVPHDLNRTQEVLSYPKHFT
HHSKDQYSQCCFQYFGPDEAFHTKAILTPEMFYVQETSRTCNNYDKSFDEVTIPAQYMTQ
LRKQTLGWNICHKIFPNKTELSNHDAMHTGENDDKCDYEKPIINKSLYLTKHQEAHAGIE
PQAHKENIKFFCLDAELQTVDPELHGEKQVYECKVSGKTFRHQPEHISQQRPHACERACQ
AKEHGEAGCDEPALTQHQRLCTEEKACEGKACSKAFHHKSLLPQYQSARADEQQSDCKEL
MKIYFYVSSPTQHHGPPPPEKPFRCNDCLKTFSHKSQLERHQRMHTGEKPHECKECRKAF
CHKSHLIRHQGIHAPEKPYECNECKKSFYLRSQLTLHERTHTGEKPFECKECRKAFSRNS
HLTQHQKIHTGEKPHKCKECGNAFARKSHLIQHQKTHTGERPYECKECRKAFSRKSQLMQ
HETTHTGERAYECKECRKTFYLKAYLTRHQVIHQSEKPFECKKCGKAFSRKSYLTRHQKI
HKGQTLSG
Download sequence
Identical sequences Q7TPL8
10090.ENSMUSP00000067316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]