SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7TQG7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7TQG7
Domain Number 1 Region: 242-440
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.36e-48
Family Reprolysin-like 0.0002
Further Details:      
 
Domain Number 2 Region: 457-533
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 4.32e-19
Family Blood coagulation inhibitor (disintegrin) 0.00053
Further Details:      
 
Weak hits

Sequence:  Q7TQG7
Domain Number - Region: 688-715
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00134
Family Integrin beta EGF-like domains 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q7TQG7
Sequence length 778
Comment (tr|Q7TQG7|Q7TQG7_MOUSE) Disintegrin and metalloproteinase domain-containing protein 11 {ECO:0000313|Ensembl:ENSMUSP00000069466} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=mCG_7457 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MRRLRRWAIAALLLLPLLPPPGLGALGPRGALHWRSSAHVGSPESPEGSEVTEPSRLVRQ
SSGGEVRKPQLDTRVRQDPPRGTPVHLAQVSFVIPAFDSNFTLDLELNHHLLSSQYVERH
FSREGTRQHSTGAGDHCYYHGKLRGNPQSFAALSTCQGLHGVFSDGNLTYIVEPKEIAGP
WGPPQGPLPHLIYRTPLLPAPLGCREPGCLFAVPAQSALPNWPKLRRKRQVRRGHPTVHS
ETKYVELIVINDHQLFEQMRQSVVLTSNFAKSVVNLADVIYKEQLNTRIVLVAMETWADG
DKIQVQDDLLETLARLMVYRREGLPEPSDATHLFSGRTFQSTSSGAAYVGGICSLSRGGG
VNEYGNMGAMAVTLAQTLGQNLGMMWNKHRSSAGDCKCPDIWLGCIMEDTGFYLPRKFSR
CSIDEYNQFLQEGGGSCLFNKPLKLLDPPECGNGFVEAGEECDCGSVQECSRAGGNCCKK
CTLTHDAMCSDGLCCRRCKYEPRGVSCREAVNECDIAETCTGDSSQCPPNLHKLDGYYCD
HEQGRCYGGRCKTRDRQCQALWGHAAADRFCYEKLNVEGTERGNCGRKGSGWVQCSKQDV
LCGFLLCVNISGAPRLGDLGGDISSVTFYHQGKELDCRGGHVQLADGSDLSYVEDGTACG
PNMLCLDHRCLPASAFNFSTCPGSGERRICSHHGVCSNEGKCICQPDWTGKDCSIHNPLP
TSPPTGETERYKGPSGTNIIIGSIAGAVLVAAIVLGGTGWGFKNIRRGRYDPTQQGAV
Download sequence
Identical sequences Q7TQG7
ENSMUSP00000069466 ENSMUSP00000069466 ENSMUSP00000099370 10090.ENSMUSP00000069466 NP_001104248.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]