SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7U7U9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7U7U9
Domain Number 1 Region: 833-1000
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.16e-17
Family Serralysin-like metalloprotease, catalytic (N-terminal) domain 0.069
Further Details:      
 
Domain Number 2 Region: 480-575
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000128
Family Collagen-binding domain 0.012
Further Details:      
 
Domain Number 3 Region: 351-448
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000183
Family Collagen-binding domain 0.017
Further Details:      
 
Domain Number 4 Region: 1084-1158
Classification Level Classification E-value
Superfamily CalX-like 0.0000615
Family CalX-beta domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q7U7U9
Sequence length 1159
Comment (tr|Q7U7U9|Q7U7U9_SYNPX) Uncharacterized protein {ECO:0000313|EMBL:CAE07396.1} KW=Complete proteome; Reference proteome OX=84588 OS=Synechococcus sp. (strain WH8102). GN=SYNW0881 OC=Synechococcus.
Sequence
MFRQGYLKFKIYFNLLPLQSLQFTSEKTKDNDLVDSSKMSQSYSSVGKLDRKSFKPSGSD
YILSPPSSYSKRFATKFKNFNAKSDVISIDLSDFNTTLTGIYIARSKKEFKKAQKSDSAF
IYNWKNGRLFFNENGSAKKYGDGGLIARFAKKTRLNEENIIFNFGIHSTSTPDPTPTPSY
SITADKISVDEGDRVNWTITTKNVRKGTRIFVSDVFERSNNIYDNYSDMDGYALGSDGWE
SYYFKVNSKGKVKFWDEWNEDGITEGDDSYYYQFYEDPDFTELLATSKTVEIIDTSQAPS
ATPTPEPTPAPSATPTPEPTPEPSTTPTPEPTPEPSTDQGFLDDFANNSSTSGVISVGDI
VSSDLETTDDEDWFQISLTEERVYQFDLEGIQLTDPRMSLHGPSLEELIYDDDGGSGYNS
KIEFIATSSDNYFISAKSWGETGTYTLKAIDITPTPEPTPEPSTGQGLLDDFANNLSTSG
VISVGVIVSGDLETTDDEDWFQVSLKEGRVYQFDLEGIQLTDPQMSLHGPSSEELIYDDD
GGSGYNSKIEFIATSSDNYFISAKSWWETGTYTLKAIDITPTPEPTPAPSTTPTPEPTPE
PSTTPTPEPTPAPATTPTPEPTPAPSATPTPEPTPAPSATPTPEPTPAPATTPTPEPIPV
PTPEQDSSPTPTGNPTNTTDGVFLYGPRPMQSAIKTFSGTVGVGGEVDRFEISFLAGDVV
SLSVEAADNTWPLLRLVDAEGRILDPVSAYNNNSASTSGYRVDVDAMLFAEVYAQNSFTG
SYKLYVERFINESPLRPIPNELLILVEQDATNSADQYSSRYLYSDSGLIYISFDSSLSDE
LKSWWEDVFAATDAVIEPEFVVVPQSHPKSQLVVNQTSSYYVSGDHAGIYQSPSYTYSEL
SDESAYNFQRKNNQGEILLAEAAFSHSTRFGGSREAGWKSVAFHELGHALGLEHPHDSSD
GDVDRIIDTNGTVMSYEKTQDSDGDPGFTDLDVNALQFVYGTETGVLTPSPLEGIPLLIE
SRTFDLSKRWKSPILSAEWIGGYTIQEPSSGLSTKVLQLTRSEGYLENESKIWLDFDLGD
GLKNWNSLNGYSEGFHDVLILGNSVTFEPGEATALFDLPIVAGSHAESDEWVDVTVRPEY
PDLYKAVPDSALRLTIVDA
Download sequence
Identical sequences Q7U7U9
84588.SYNW0881 gi|33865415|ref|NP_896974.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]