SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7XIP0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q7XIP0
Domain Number - Region: 25-198
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0502
Family FCH domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q7XIP0
Sequence length 608
Comment (tr|Q7XIP0|Q7XIP0_ORYSJ) FRIGIDA-like protein {ECO:0000256|RuleBase:RU364012} KW=Complete proteome; Reference proteome OX=39947 OS=Oryza sativa subsp. japonica (Rice). GN=OSNPB_070592300 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MATEDTSHISGSSESTIPLLEQLAEVFGKLKSHTETSLQLQNGINWEDIKAHFLNLEKSY
KSKCDELAEKQKALEEKKAESCRLIAEKEANVSAKERAFLNQFQELRDTAVSALSEVRQK
YKVELAGILDANGSKDKKVRTSTNDMNALCASEENTTASGLGEPSEASPVDVKPRPVLKQ
LCEQMDTAGLLKFLSENWKKLSSLRDELSAALRCATDPARFVLGSLEGFFPSDHTSSPGN
KQIILQGQRRSCIILMEAITPALATKEPGDNHPWSSEIRELAKAIAEEWKSKLAEVDLDA
SDGYSLEAQAFLQLLTTFNVDSVLDEDELCKLVVAVSRRKQTAELCRSLCLNERIPDIIK
ELVNRHRQIDAVQFIHAFGLSESFPPAPLLKTYVEELKDSLGNNGDGNAASLKDDPKTRE
LLALRAVIKCIEEYKLQKDYPLGPLQKRVAELKSKGEKRPLEAGRHNAKKPRTFGNSAAR
RPPNPVGSAGRRPSGPAGTWQRPPPPMPSYPDRYGHADRYHYTAPSATYDPPAYASYSEP
YSASKPYQYTPGSVAPASYNSNQFKVAYGGPGAPPTAGGYGSYNDAAGQSTSSSYSGYSG
YHPSLPRL
Download sequence
Identical sequences I1QBV3 Q7XIP0
XP_015647752.1.37577 39947.LOC_Os07g40270.1 LOC_Os07g40270.1|13107.m04185|protein LOC_Os07g40270.1|PACid:21900636 ORGLA07G0159500.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]