SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7Z1U2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7Z1U2
Domain Number 1 Region: 9-28,60-104
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.0000569
Family Duffy binding domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q7Z1U2
Sequence length 131
Comment (tr|Q7Z1U2|Q7Z1U2_PLAFA) Var2csa {ECO:0000313|EMBL:AAP37913.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN= OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
GDGTAGSPWSKRWDQIYKRYSKHIEDAKRNRKAGTKNCGTSSTTNAAENKCVQSDIDSFF
KHLIDIGLTTPSSYLSNVLDENSCGDDKAPWTTYTTYTTTEKCNKERDKSKLPQSNTAVV
VNVPSPLGNTP
Download sequence
Identical sequences Q7Z1U2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]