SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7Z3Y9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7Z3Y9
Domain Number 1 Region: 315-393
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.09e-20
Family Intermediate filament protein, coiled coil region 0.0012
Further Details:      
 
Domain Number 2 Region: 81-115
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000214
Family Intermediate filament protein, coiled coil region 0.0025
Further Details:      
 
Weak hits

Sequence:  Q7Z3Y9
Domain Number - Region: 197-313
Classification Level Classification E-value
Superfamily Prefoldin 0.000418
Family Prefoldin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q7Z3Y9
Sequence length 468
Comment (sp|Q7Z3Y9|K1C26_HUMAN) Type I inner root sheath-specific keratin-K25irs2 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=KRT25B OC=Catarrhini; Hominidae; Homo.
Sequence
MSFRLSGGSRRICSRTGSGRLSGGGTGFVAGNVCVGSGARSSFSCTLEGISSGGSFCNSG
GGLGSGACAGFLGNEHSLLSGNEKVTMQNLNDRLASYLDHVHALEEANADLEQKIKGWYE
KCEPGSSREHDHDYSRYFSVIEDLKRQIISATICNASIVLQNDNARLTADDFRLKYENEL
ALHHSVEADTSGLRRVLDELTLCTTDLEIQCETLSEELTYLKKSHEEEMEVLQYTAGGNV
NVEMNATPGVDLTVLLNNMRAEYEDLAEQNRKDAEAWFNERSATLQQQISDHEGAATAAR
NELTELKRNLQTLEIELQSLMAVKHSYECSLAETEGNYCNQLQQIQDQIGVMEEQLQQIR
TETEGQKLEYEQLLDVKIFLEKEIDIYCNLLDGEERKSKSTCYKSKGYRPVNSGNQAKDS
TEETIVKTVVEELDQIGNLLSLRVHSVEEKSSKISNITVEQRVPSKAP
Download sequence
Identical sequences Q7Z3Y9
9606.ENSP00000334798 ENSP00000334798 ENSP00000334798 NP_853517.2.87134 NP_853517.2.92137 gi|254675185|ref|NP_853517.2| ENSP00000334798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]