SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7Z4G1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q7Z4G1
Domain Number - Region: 30-81
Classification Level Classification E-value
Superfamily Sec7 domain 0.0589
Family Sec7 domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q7Z4G1
Sequence length 85
Comment (sp|Q7Z4G1|COMD6_HUMAN) COMM domain-containing protein 6 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=COMMD6; OC=Catarrhini; Hominidae; Homo.
Sequence
MEASSEPPLDAKSDVTNQLVDFQWKLGMAVSSDTCRSLKYPYVAVMLKVADHSGQVKTKC
FEMTIPQFQNFYRQFKEIAAVIETV
Download sequence
Identical sequences Q7Z4G1
NP_987091.1.87134 NP_987091.1.92137 gi|45333906|ref|NP_987091.1| ENSP00000366841 ENSP00000385660 ENSP00000366841 ENSP00000385660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]