SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7Z9J5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7Z9J5
Domain Number 1 Region: 3-224
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.19e-61
Family Glutathione peroxidase-like 0.00000173
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q7Z9J5
Sequence length 233
Comment (tr|Q7Z9J5|Q7Z9J5_CRYNV) Thiol-specific antioxidant protein 3 {ECO:0000313|EMBL:AAP68995.1} OX=178876 OS=grubii). GN=TSA3 OC=Cryptococcus neoformans species complex.
Sequence
MSLRLGDIAPDFEADTTHGRIKFHDWLDGSWAILFSHPDDYTPVCTTELSAVALSYADFA
SRGVKLIGLSANNVASHEGWIKDINALNPDGPGLEFPIIGDEDRTVSELYGMLDKLDKTN
VDKKGIPFTVRTVFVIDPKKQIRLTLAYPASTGRNFPEILRVIDSLQLGDKHRITTPANW
GIPDPKTGQVEERVIVHPSVQGEEVKQLFGDDVQIVYPYLRFTSNPSKKEVKA
Download sequence
Identical sequences J9VIY0 Q7Z9J5
CNAG_06917T0 XP_012048348.1.45702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]