SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7ZX73 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7ZX73
Domain Number 1 Region: 257-529
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.15e-83
Family Protein kinases, catalytic subunit 0.00000000013
Further Details:      
 
Domain Number 2 Region: 147-291
Classification Level Classification E-value
Superfamily SH2 domain 5.12e-39
Family SH2 domain 0.00000175
Further Details:      
 
Domain Number 3 Region: 60-157
Classification Level Classification E-value
Superfamily SH3-domain 8.14e-23
Family SH3-domain 0.0000334
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q7ZX73
Sequence length 537
Comment (tr|Q7ZX73|Q7ZX73_XENLA) Tyrosine-protein kinase {ECO:0000256|RuleBase:RU362096} OX=8355 OS=Xenopus laevis (African clawed frog). GN=src OC=Xenopus.
Sequence
MGATKSKPREGGPRSRSLDIAEGSHQPFTSLSASQTPSKSLDSHRPPGQPFGGNCDLTPF
GGVNFSDTITSPQRTGPLAGGVTTFVALYDYESRTETDLSFRKGERLQIVNNTRPDMREG
DWWLARSLSSGQTGYIPSNYVAPSDSIQAEEWYLGKITRREAERLLLSLENPRGTFLVRE
SETTKGAYCLSVSDYDASRGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYYSKHADG
LCHRLTAVCPTAKPQTQGLSKDAWEIPRDSLRLELKLGQGCFGEVWMGTWNGTTRVAIKT
LKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGEMGR
YLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEY
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVE
RGYRMPCPPDCPESLHDLMFQCWRKDPEERPTFEYLQAFLEDYFTATEPQYQPGDNL
Download sequence
Identical sequences Q7ZX73
gi|148236015|ref|NP_001080738| gi|28175414|gb|AAH45134| NP_001080738.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]