SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q811T3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q811T3
Domain Number 1 Region: 287-543
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.32e-56
Family Voltage-gated potassium channels 0.00096
Further Details:      
 
Domain Number 2 Region: 90-194
Classification Level Classification E-value
Superfamily POZ domain 9.42e-32
Family Tetramerization domain of potassium channels 0.0000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q811T3
Sequence length 769
Comment (tr|Q811T3|Q811T3_RAT) Potassium voltage-gated channel subfamily C member 3 {ECO:0000313|Ensembl:ENSRNOP00000027063} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=rCG_53749 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MLSSVCVWSFSGRQGTRKQHSQPAPTPQPPESSPPPLLPPPQQQCAQPGTAASPAGAPLS
CGPGGRRAEPCSGLPAVAMGRHGGGGGDSGKIVINVGGVRHETYRSTLRTLPGTRLAGLT
EPEAAARFDYDPGTDEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELGFWGIDE
TDVEACCWMTYRQHRDAEEALDSFEAPDSSGNANANAGGAHDAGLDDEAGAGGGGLDGAG
GELKRLCFQDAGGGAGGPAGGPGGAGGTWWRRWQPRVWALFEDPYSSRAARYVAFASLFF
ILISITTFCLETHEGFIHISNKTVTQASPIPGAPPENITNVEVETEPFLTYVEGVCVVWF
TFEFLMRVTFCPDKVEFLKSSLNIIDCVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFV
RILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGADPDDI
LGSNHTYFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIV
NNFGMYYSLAMAKQKLPKKKNKHIPRPPQPGSPNYCKPDPPPPPPPHPHHGSGGISPPPP
ITPPSMGVTVAGAYPPGPHTHPGLLRGGAGGLGIMGLPPLPAPGEPCPLAQEEVIETNRA
DPRPNGDPAAAALAHEDCPAIDQPAMSPEDKSPITPGSRGRYSRDRACFLVTDYAPSPDG
SIRKGYEKSRSLSSIVGLSGVSLRLAPLATPPGSPRATRRAPPTLPSIL
Download sequence
Identical sequences Q811T3
ENSRNOP00000027063 NP_446449.2.100692 NP_446449.2.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]