SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q820Y9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q820Y9
Domain Number 1 Region: 7-147
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.62e-44
Family Ribonuclease PH domain 1-like 0.000000893
Further Details:      
 
Domain Number 2 Region: 332-503
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.6e-40
Family Ribonuclease PH domain 1-like 0.00000157
Further Details:      
 
Domain Number 3 Region: 485-584
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.94e-22
Family Ribonuclease PH domain 2-like 0.0000298
Further Details:      
 
Domain Number 4 Region: 148-257
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.16e-21
Family Ribonuclease PH domain 2-like 0.0000363
Further Details:      
 
Domain Number 5 Region: 586-697
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.01e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 
Domain Number 6 Region: 257-361
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.000000000101
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q820Y9
Sequence length 735
Comment (sp|Q820Y9|PNP_TROW8) Polynucleotide phosphorylase {ECO:0000255|HAMAP-Rule:MF_01595} OX=218496 OS=Tropheryma whipplei (strain TW08/27) (Whipple's bacillus). GN=pnp OC=Bacteria; Actinobacteria; Micrococcales; Tropheryma.
Sequence
MQFSEGVIDNGRFGTRTIRFETGRLARQAQGSVVAYLDGETMLLSSTSVGKQPKEDCDFF
PLTVDVEERSYAAGKIPGSYFRREGRPSTEAILACRLIDRPLRPSFNAGLRNEVQVIVTV
LSIAPGEFYEALAINAASASTLVSGLPFSGPIGGVRLALIDGQWVAFPRYEDLSGAVFDL
TVAGRVFVNESGKEDIAIMMVEAEATEPAWDLIHSHGAKKPNEEVIEEGIESAKVFIRTL
CDIQRDLASKLSLSHTEPDLYPDYSDSVHSFVEGLVKSDLEKVYRGNHDSGYAPNALSAS
DEIKQKAYDAFHDAVLSGRFDQDSLSQFPHAYKAVLKDVVRTCVLEGFARMDGRGLSDIR
PLDAEVQVVPRVHGSAVFQRGETQVLGVTTLNMLKMEQQIDSLAPIVSKRYIHHYNFPPY
STGEVGRVGSPKRREIGHGFLAERALVPVLPSREDFPYAIRQVSEALGSNGSTSMGSVCA
STLSLLNAGVPLRAPVAGIAMGLISGRVDGEMRYVTLTDISGSEDALGDMDFKVAGTSDF
ITALQLDTKLDGIPAHVLSEALAHARSARLAILDVLTRVIDSPDQMSEYAPRVVRVKIPV
QKIGELIGPKGKVINSIQDETGAEISIEDDGTVYIGSSQADSSEKAVAMVNSIVNPVEPC
VGSQFLGTVVKNMPFGSFISLVPGKDGLLHISEIRKMVDGRHLESVDEVLSVGQKVLVEV
SKIDDRGKLCLVAVK
Download sequence
Identical sequences Q820Y9
218496.TW347 gi|28572501|ref|NP_789281.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]