SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q84PA4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q84PA4
Domain Number - Region: 70-183
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.022
Family BAR domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q84PA4
Sequence length 211
Comment (tr|Q84PA4|Q84PA4_ORYSJ) cDNA clone:J013049M17, full insert sequence {ECO:0000313|EMBL:BAG89777.1} KW=Complete proteome; Reference proteome OX=39947 OS=Oryza sativa subsp. japonica (Rice). GN=OSNPB_030278900 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MATAMMAATATSCSPRRAPVVASSSVQPPRRQQQQQPRRGLKQLPGLVATAAVAVAAAPL
PALAEQMEKAALFDFNLTLPLIATEFLLLMVALDKLYFTPLGKFMDERDAKIRAELGGVK
DASEEVRQLEEQAAAVLKAARAEIAAALNKMKKETTQELEAKLDEGRRRVEAELVEALAN
LEAQKEEAVKALDAQIASLSDEIVKKVLPSA
Download sequence
Identical sequences Q84PA4
LOC_Os03g17070.1|PACid:21915204 39947.LOC_Os03g17070.1 XP_015630476.1.37577 LOC_Os03g17070.1|13103.m02041|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]