SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q86B82 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q86B82
Domain Number 1 Region: 13-289
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 6.25e-64
Family Penicillin synthase-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q86B82
Sequence length 322
Comment (tr|Q86B82|Q86B82_DROME) IP08537p {ECO:0000313|EMBL:AAY55446.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG33093 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MKSETETLLLQNAVPIIDLENTIEDVATNLREALSEKGYALLINHGISNEKIKKAWKYFD
GFVDLTDEVKLAFERSKAPDGENHGYVSPGMERFDGRTPELRHAYNICKLQDKFLPEQQL
PGFSRHINSLVDDFNELGRFILKALAISLDAPPSFFTDKHSFMLSDDRFNLTTLRMLFYP
PVEDQDHGRSFIRCGAHADYCTFTLLAQDSEGGLEVKLRGSDKWERVGHLPGALFINCGE
TMAIWTDQFYHALQHRVVIPDQVDIRHRGRHSIAYFCHPDNSALINPKDLNITTKQTTSD
VIQNAYDITMALAKGAFAHHYS
Download sequence
Identical sequences Q86B82
FBpp0083680 FBpp0083680 NP_788715.2.81976 7227.FBpp0083680 FBpp0083680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]