SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q86BN2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q86BN2
Domain Number 1 Region: 235-306
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000502
Family Canonical RBD 0.046
Further Details:      
 
Domain Number 2 Region: 165-192
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000576
Family CCCH zinc finger 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q86BN2
Sequence length 314
Comment (tr|Q86BN2|Q86BN2_DROME) CG3294, isoform B {ECO:0000313|EMBL:AAO41150.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG3294 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MPGRKARRKLIKKQQRKRRRQKHAKERDKLEEEAENQRLMQPEYQKWSQEQEEMQEFQRL
ADERERQLAEESWLRREATAQRQFQMDEAKKRQEQEEVERLQREQAKERAEREERQRKQR
EEETRKAAKAAAEFDAMMESMDEYLNNPRIEKPPSHLLRVMETHPEERACEFFSRTNCCR
YGHACTFNHRRPMLGRILLIRHFFNHSMLQKRCTHKEYASAEEHLELTEQDLRHDYDEFF
NDVVEELRKFGTIVNFRTVRNTLEHLRGHVFVEYTNERSALRAFTNLQGRYYASKRLNVE
FSNLRTWRGAVCGT
Download sequence
Identical sequences Q86BN2
FBpp0077074 NP_787976.1.81976 FBpp0077074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]