SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q86BQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q86BQ6
Domain Number 1 Region: 323-520
Classification Level Classification E-value
Superfamily Kelch motif 6.67e-56
Family Kelch motif 0.000028
Further Details:      
 
Domain Number 2 Region: 52-172
Classification Level Classification E-value
Superfamily POZ domain 2.92e-31
Family BTB/POZ domain 0.0014
Further Details:      
 
Domain Number 3 Region: 529-611
Classification Level Classification E-value
Superfamily Kelch motif 7.98e-21
Family Kelch motif 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q86BQ6
Sequence length 625
Comment (tr|Q86BQ6|Q86BQ6_DROME) Uncharacterized protein, isoform F {ECO:0000313|EMBL:AHN59517.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG17754 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MSAVNQKESPSRDSTASTSGHISMLADNTLESLSRDYSLGSLNSAGSQDEFFRCRDHADN
ILKRMQLYVDSQQLCDVVLIAGIDGKRVPAHRLVLSASSAYFSAMFTGSLRETKEQEVTL
GEVHGDALHLLVQYCYTGFIEMREDTVETLLATACLLQLNAVVTACCNFLARQLHPSNCL
GFAFFAEQQSCTTLLRLAQAYTCQYFMQVCQNQEFFQLNADQLGKLLSSDDLNVPSEQDV
FHSLMSWVRHDSAAREQHIPELLALVRLPLLQPAFIMDHVENVCNANECQQLVMEAFKWH
LMPERRSRIATERTTPRKSTVGRLLAVGGMDAHKGAISIESYCPRLDKWTPWKHMTGRRL
QFGAAVMEDKLILVGGRDGLKTLNTVESLDLNTMAWAPLNAMATPRHGLGVAVLEGPLYA
VGGHDGWSYLNTVERWDPIARTWSYVAPMSSMRSTAGVAVLGGRLYAVGGRDGSVCHRSI
ECYDPHTNKWSLLAPMNRRRGGVGVTVANGFLYALGGHDCPASNPMVCRTETVERYDPAT
DTWTLICSLALGRDAIGCALLGDRLIVVGGYDGNHALKSVEEYDPVRNGWNELAPMAFAR
AGACVVAIPNVIPPAAQQPPPSATV
Download sequence
Identical sequences Q86BQ6
FBpp0071250 FBpp0071250 NP_001285046.1.81976 NP_788894.1.81976 XP_016038666.1.80810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]