SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q86MU3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q86MU3
Domain Number 1 Region: 5-33,67-172,225-245
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.09e-30
Family Duffy binding domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q86MU3
Sequence length 245
Comment (tr|Q86MU3|Q86MU3_PLAFA) Erythrocyte membrane protein 1 {ECO:0000313|EMBL:AAO67384.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=var OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
LHKIEGVDTTESVIEWFVKSAAVETFFLWHKYKEEKKPPATQNGALPLPLAPDVSQEDDP
QKKLEKGDIPEEFKRQMFYTLGDYRDICIGGDRDIVGDTIVSNTDSTEKSSGKATKISDV
IKEFLSKQNSGDNPSPRSVKTGSNSGNDPASLWNKHAESIWNGMICALTYKDGGEGKSPQ
VDDKVKKALLDGEGKKPKNNGQQDYTYEKVELKDNDENGGPRTTGASIKTEPTKLTDFVK
RPPYF
Download sequence
Identical sequences Q86MU3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]